PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010091315.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family MYB
Protein Properties Length: 556aa    MW: 61104.8 Da    PI: 5.0616
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010091315.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.82.5e-183986148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed llv++vk++G g+W+++ ++ g+ R++k+c++rw ++l
   XP_010091315.1 39 KGPWTSSEDALLVEYVKKHGEGNWNAVQKHSGLSRCGKSCRLRWANHL 86
                     79******************************************9986 PP

2Myb_DNA-binding491.4e-1592135146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g+++++E+ l++++++++G++ W++ a++++ gRt++++k++w++
   XP_010091315.1  92 KGAFSQDEERLIIELHAKMGNK-WARMASHLP-GRTDNEIKNYWNT 135
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.3423486IPR017930Myb domain
SMARTSM007172.6E-163888IPR001005SANT/Myb domain
SuperFamilySSF466891.61E-3038133IPR009057Homeodomain-like
PfamPF002492.2E-163986IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-234093IPR009057Homeodomain-like
CDDcd001672.45E-124186No hitNo description
PROSITE profilePS5129425.32187141IPR017930Myb domain
SMARTSM007173.5E-1691139IPR001005SANT/Myb domain
PfamPF002491.1E-1492135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2494140IPR009057Homeodomain-like
CDDcd001677.56E-1294135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 556 aa     Download sequence    Send to blast
MSWTTNESED GVLSKYHSES PLIDESNGGS SGGGVLLKKG PWTSSEDALL VEYVKKHGEG  60
NWNAVQKHSG LSRCGKSCRL RWANHLRPNL RKGAFSQDEE RLIIELHAKM GNKWARMASH  120
LPGRTDNEIK NYWNTRIKRR QRAGLPLYPP DLCLQAFQEN QQGQNTGGIS CGDRGQHDPL  180
QVNSFEIPDV VFDGLKANTE VLSYVSDLTD MSMNTMLLKG MSPQYYSFVP PTIHRQKRLR  240
ESSDVFPDSA GCVQNGFPLF DQFQNDPGDK VASSFGASFR PDLDPNKSLL SFDVTQGDHS  300
LPNGNSSASK PIHGAVKLEL PSLQYPETDL GTWGTSPPPP VLESVDAFIQ SPPPVGAFES  360
DCSSPRNSGL LDALIHEAKN LSSGQKHSDK SKNSSSISPS DMADNGTLNV CENEWDEYRE  420
PISPFGHSDT SFMNECFSAS GSSLDDPPSA ETFTGSVVKP EPVYADLLPY KVRESKRQTD  480
FTRPDALLGS DLFEQSFGCI RGHGIMTDTI ATLNGDNSAA DYMHLPSASS PLSQEWGFNY  540
CVWNNMPPVC HMSDLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-32371405107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00348DAPTransfer from AT3G11440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010091315.10.0Transcription factor GAMYB
TrEMBLW9QVM80.0W9QVM8_9R
STRINGVIT_13s0067g01630.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.11e-127myb domain protein 65